Protein Info for Rv3155 in Mycobacterium tuberculosis H37Rv

Annotation: Probable NADH dehydrogenase I (chain K) NuoK (NADH-ubiquinone oxidoreductase chain K)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 99 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 29 to 49 (21 residues), see Phobius details amino acids 59 to 82 (24 residues), see Phobius details PF00420: Oxidored_q2" amino acids 6 to 99 (94 residues), 106.4 bits, see alignment E=2.5e-35

Best Hits

Swiss-Prot: 100% identical to NUOK_MYCTA: NADH-quinone oxidoreductase subunit K (nuoK) from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)

KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 95% identity to mav:MAV_4043)

MetaCyc: 42% identical to ferredoxin-menaquinone dehydrogenase subunit K (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (99 amino acids)

>Rv3155 Probable NADH dehydrogenase I (chain K) NuoK (NADH-ubiquinone oxidoreductase chain K) (Mycobacterium tuberculosis H37Rv)
MNPANYLYLSVLLFTIGASGVLLRRNAIVMFMCVELMLNAVNLAFVTFARMHGHLDAQMI
AFFTMVVAACEVVVGLAIIMTIFRTRKSASVDDANLLKG