Protein Info for Rv3153 in Mycobacterium tuberculosis H37Rv

Annotation: Probable NADH dehydrogenase I (chain I) NuoI (NADH-ubiquinone oxidoreductase chain I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 37 to 164 (128 residues), 138.6 bits, E=3.8e-45
• PF13237: Fer4_10
  • amino acids 78 to 137 (60 residues), 32.6 bits, E=4.3e-11
• PF00037: Fer4
  • amino acids 79 to 97 (19 residues), 29.9 bits, see alignment (E = 2.3e-10)
  • amino acids 119 to 142 (24 residues), 37 bits, see alignment (E = 1.3e-12)
• PF12800: Fer4_4
  • amino acids 79 to 93 (15 residues), 14.6 bits, see alignment (E = 2.4e-05)
  • amino acids 125 to 138 (14 residues), 21.2 bits, see alignment (E = 1.8e-07)
• PF12838: Fer4_7
  • amino acids 80 to 140 (61 residues), 48.1 bits, E=8.3e-16
• PF13187: Fer4_9
  • amino acids 80 to 140 (61 residues), 33.9 bits, E=1.7e-11
• PF12798: Fer4_3
  • amino acids 81 to 95 (15 residues), 14.7 bits, see alignment (E = 3e-05)
  • amino acids 126 to 140 (15 residues), 18.9 bits, see alignment (E = 1.4e-06)
• PF12797: Fer4_2
  • amino acids 121 to 138 (18 residues), 25.6 bits, see alignment (E = 5.3e-09)
• PF12837: Fer4_6
  • amino acids 121 to 141 (21 residues), 25.8 bits, see alignment (E = 5e-09)

Best Hits

Swiss-Prot: 100% identical to NUOI_MYCTU: NADH-quinone oxidoreductase subunit I (nuoI) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 99% identity to mbb:BCG_3176)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (211 amino acids)

>Rv3153 Probable NADH dehydrogenase I (chain I) NuoI (NADH-ubiquinone oxidoreductase chain I) (Mycobacterium tuberculosis H37Rv)
VANTDRPALPHKRAVPPSRADSGPRRRRTKLLDAVAGFGVTLGSMFKKTVTEEYPERPGP
VAARYHGRHQLNRYPDGLEKCIGCELCAWACPADAIYVEGADNTEEERFSPGERYGRVYQ
INYLRCIGCGLCIEACPTRALTMTYDYELADDNRADLIYEKDRLLAPLLPEMAAPPHPRT
PGATDKDYYLGNVTAEGLRGVRESQTTGDSR