Protein Info for Rv3152 in Mycobacterium tuberculosis H37Rv

Annotation: Probable NADH dehydrogenase I (chain H) NuoH (NADH-ubiquinone oxidoreductase chain H)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 315 to 339 (25 residues), see Phobius details amino acids 347 to 367 (21 residues), see Phobius details PF00146: NADHdh" amino acids 15 to 334 (320 residues), 408.4 bits, see alignment E=9.6e-127

Best Hits

Swiss-Prot: 100% identical to NUOH_MYCTO: NADH-quinone oxidoreductase subunit H (nuoH) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 100% identity to mtu:Rv3152)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>Rv3152 Probable NADH dehydrogenase I (chain H) NuoH (NADH-ubiquinone oxidoreductase chain H) (Mycobacterium tuberculosis H37Rv)
MTTFGHDTWWLVAAKAIAVFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGPKGALQSLA
DGIKLALKESITPGGIDRFVYFVAPIISVIPAFTAFAFIPFGPEVSVFGHRTPLQITDLP
VAVLFILGLSAIGVYGIVLGGWASGSTYPLLGGVRSTAQVISYEVAMGLSFATVFLMAGT
MSTSQIVAAQDGVWYAFLLLPSFVIYLISMVGETNRAPFDLPEAEGELVAGFHTEYSSLK
FAMFMLAEYVNMTTVSALAATLFFGGWHAPWPLNMWASANTGWWPLIWFTAKVWGFLFIY
FWLRATLPRLRYDQFMALGWKLLIPVSLVWVMVAAIIRSLRNQGYQYWTPTLVFSSIVVA
AAMVLLLRKPLSAPGARASARQRGDEGTSPEPAFPTPPLLAGATKENAGG