Protein Info for Rv3147 in Mycobacterium tuberculosis H37Rv

Annotation: Probable NADH dehydrogenase I (chain C) NuoC (NADH-ubiquinone oxidoreductase chain C)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01961: NADH (or F420H2) dehydrogenase, subunit C
  • amino acids 95 to 215 (121 residues), 147.8 bits, E=1e-47
• PF00329: Complex1_30kDa
  • amino acids 95 to 216 (122 residues), 142.2 bits, E=6.4e-46

Best Hits

Swiss-Prot: 100% identical to NUOC_MYCBT: NADH-quinone oxidoreductase subunit C (nuoC) from Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

KEGG orthology group: K00332, NADH dehydrogenase I subunit C [EC: 1.6.5.3] (inferred from 100% identity to mra:MRA_3180)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain C (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (236 amino acids)

>Rv3147 Probable NADH dehydrogenase I (chain C) NuoC (NADH-ubiquinone oxidoreductase chain C) (Mycobacterium tuberculosis H37Rv)
MSPPNQDAQEGRPDSPTAEVVDVRRGMFGVSGTGDTSGYGRLVRQVVLPGSSPRPYGGYF
DDIVDRLAEALRHERVEFEDAVEKVVVYRDELTLHVRRDLLPRVAQRLRDEPELRFELCL
GVSGVHYPHETGRELHAVYPLQSITHNRRLRLEVSAPDSDPHIPSLFAIYPTNDWHERET
YDFFGIIFDGHPALTRIEMPDDWQGHPQRKDYPLGGIPVEYKGAQIPPPDERRGYN