Protein Info for Rv3146 in Mycobacterium tuberculosis H37Rv

Annotation: Probable NADH dehydrogenase I (chain B) NuoB (NADH-ubiquinone oxidoreductase chain B)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 11 to 152 (142 residues), 227.3 bits, E=3.1e-72
• PF01058: Oxidored_q6
  • amino acids 37 to 146 (110 residues), 104.8 bits, E=1.4e-34

Best Hits

Swiss-Prot: 100% identical to NUOB_MYCBT: NADH-quinone oxidoreductase subunit B (nuoB) from Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 98% identity to mul:MUL_2460)

MetaCyc: 44% identical to F420H2 dehydrogenase subunit FpoB (Methanosarcina mazei)
RXN-8106 [EC: 1.5.98.3]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• coenzyme B/coenzyme M regeneration I (methanophenazine-dependent) (1/4 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.5.98.3 or 1.6.5.3

Protein Sequence (184 amino acids)

>Rv3146 Probable NADH dehydrogenase I (chain B) NuoB (NADH-ubiquinone oxidoreductase chain B) (Mycobacterium tuberculosis H37Rv)
VGLEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMATAGPRFDIARFGMERF
SATPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPKWVLAMGVCASSGGMFNNYAIVQGVD
HVVPVDIYLPGCPPRPEMLLHAILKLHEKIQQMPLGINRERAIAEAEEAALLARPTIEMR
GLLR