Protein Info for Rv3145 in Mycobacterium tuberculosis H37Rv

Annotation: Probable NADH dehydrogenase I (chain A) NuoA (NADH-ubiquinone oxidoreductase chain A)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00507: Oxidored_q4
  • amino acids 19 to 127 (109 residues), 108.5 bits, E=8.3e-36

Best Hits

Swiss-Prot: 99% identical to NUOA_MYCBO: NADH-quinone oxidoreductase subunit A (nuoA) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 99% identity to mbo:Mb3169)

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (128 amino acids)

>Rv3145 Probable NADH dehydrogenase I (chain A) NuoA (NADH-ubiquinone oxidoreductase chain A) (Mycobacterium tuberculosis H37Rv)
LNVYIPILVLAALAAAFAVVSVVIASLVGPSRFNRSKQAAYECGIEPASTGARTSIGPGA
ASGQRFPIKYYLTAMLFIVFDIEIVFLYPWAVSYDSLGTFALVEMAIFMLTVFVAYAYVW
RRGGLTWD