Protein Info for Rv3138 in Mycobacterium tuberculosis H37Rv

Annotation: Probable pyruvate formate lyase activating protein PflA (formate acetyltransferase activating enzyme) ([pyruvate formate-lyase] activating enzyme)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 TIGR04337: AmmeMemoRadiSam system radical SAM enzyme" amino acids 9 to 355 (347 residues), 642.7 bits, see alignment E=6.3e-198 PF04055: Radical_SAM" amino acids 84 to 236 (153 residues), 70 bits, see alignment E=1.4e-23

Best Hits

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 99% identity to mbt:JTY_3156)

Predicted SEED Role

"COG1180: Radical SAM, Pyruvate-formate lyase-activating enzyme like"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>Rv3138 Probable pyruvate formate lyase activating protein PflA (formate acetyltransferase activating enzyme) ([pyruvate formate-lyase] activating enzyme) (Mycobacterium tuberculosis H37Rv)
MSDPFTIATKHWHRLHDSRIQCDVCPRACKLHEGQRGLCFVRGRFDDQVKLTSYGRSSGF
CVDPIEKKPLNHFLPGSATLSFGTAGCNLACKFCQNWDISKSREIDVLASRAAPADIART
AHELGCRSVAFTYNDPTIFWEYAADVADACHDQGIKAVAVTAGYMCPEPRAEFYRRVDAA
NVDLKAFTEDFYRKVCVSHLRNVLDTLAYLRHQTNVWLEITTLLIPGRNDSDAEVAAECR
WIRENLGVDVPVHFTAFHPDYKMMDTPATPTATLTRAREIGIGEGLRFVYTGNVHDAVGG
STSCPGCRATVIVRDWYSIRHYALTEDGRCQACGYQMPGVYDGPAGHWGQRRLPLLTSLS
RM