Protein Info for Rv3133c in Mycobacterium tuberculosis H37Rv

Annotation: Two component transcriptional regulatory protein DevR (probably LuxR/UhpA-family)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF00072: Response_reg" amino acids 4 to 115 (112 residues), 83.4 bits, see alignment E=1.4e-27 PF00196: GerE" amino acids 150 to 204 (55 residues), 63.8 bits, see alignment E=8.9e-22

Best Hits

Swiss-Prot: 100% identical to DEVR_MYCTO: DNA-binding transcriptional activator DevR/DosR (devR) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K07695, two-component system, NarL family, response regulator DevR (inferred from 100% identity to mbb:BCG_3156c)

Predicted SEED Role

"Two component transcriptional regulatory protein DevR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>Rv3133c Two component transcriptional regulatory protein DevR (probably LuxR/UhpA-family) (Mycobacterium tuberculosis H37Rv)
VVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDG
NGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGA
GRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKT
VKNYVSRLLAKLGMERRTQAAVFATELKRSRPPGDGP