Protein Info for Rv3110 in Mycobacterium tuberculosis H37Rv

Annotation: Probable pterin-4-alpha-carbinolamine dehydratase MoaB1 (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (pterin-4-a-carbinolamine dehydratase) (phenylalanine hydroxylase-stimulating protein) (PHS) (pterin carbinolamine dehydratase) (PCD)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01329: Pterin_4a
  • amino acids 32 to 119 (88 residues), 81.6 bits, E=1.9e-27

Best Hits

KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 100% identity to mtb:TBMG_00856)

Predicted SEED Role

"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)

MetaCyc Pathways

• tetrahydropteridine recycling (1/2 steps found)
• L-phenylalanine degradation V (1/3 steps found)

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.96

Use Curated BLAST to search for 4.2.1.96

Protein Sequence (131 amino acids)

>Rv3110 Probable pterin-4-alpha-carbinolamine dehydratase MoaB1 (PHS) (4-alpha-hydroxy-tetrahydropterin dehydratase) (pterin-4-a-carbinolamine dehydratase) (phenylalanine hydroxylase-stimulating protein) (PHS) (pterin carbinolamine dehydratase) (PCD) (Mycobacterium tuberculosis H37Rv)
MTVSTPEQHEQRASHDASEGKHNVCQGRLAALADAAVSEKLGALPGWQLLDMRLSRAFQC
TNFDQSIDFMNRVASIANDINHHPDIAVLDKRSVRVTAWTRKLGYLTDIDFDLAASVEAM
YATEFADRPAR