Protein Info for Rv3109 in Mycobacterium tuberculosis H37Rv

Annotation: Probable molybdenum cofactor biosynthesis protein A MoaA1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 19 to 332 (314 residues), 339.2 bits, see alignment E=1.1e-105 PF04055: Radical_SAM" amino acids 32 to 197 (166 residues), 119.2 bits, see alignment E=2.2e-38 PF06463: Mob_synth_C" amino acids 203 to 326 (124 residues), 120.3 bits, see alignment E=5.3e-39

Best Hits

Swiss-Prot: 100% identical to MOAA1_MYCTU: GTP 3',8-cyclase 1 (moaA1) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to mbo:Mb3136)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>Rv3109 Probable molybdenum cofactor biosynthesis protein A MoaA1 (Mycobacterium tuberculosis H37Rv)
MSTPTLPDMVAPSPRVRVKDRCRRMMGDLRLSVIDQCNLRCRYCMPEEHYTWLPRQDLLS
VKEISAIVDVFLSVGVSKVRITGGEPLIRPDLPEIVRTLSAKVGEDSGLRDLAITTNGVL
LADRVDGLKAAGMKRITVSLDTLQPERFKAISQRNSHDKVIAGIKAVAAAGFTDTKIDTT
VMRGANHDELADLIEFARTVNAEVRFIEYMDVGGATHWAWEKVFTKANMLESLEKRYGRI
EPLPKHDTAPANRYALPDGTTFGIIASTTEPFCATCDRSRLTADGLWLHCLYAISGINLR
EPLRAGATHDDLVETVTTGWRRRTDRGAEQRLAQRERGVFLPLSTLKADPHLEMHTRGG