Protein Info for Rv3105c in Mycobacterium tuberculosis H37Rv

Annotation: Probable peptide chain release factor 2 PrfB (RF-2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 TIGR00020: peptide chain release factor 2" amino acids 11 to 373 (363 residues), 548.2 bits, see alignment E=4e-169 PF03462: PCRF" amino acids 36 to 228 (193 residues), 190.8 bits, see alignment E=2.4e-60 PF00472: RF-1" amino acids 238 to 345 (108 residues), 129.3 bits, see alignment E=7e-42

Best Hits

Swiss-Prot: 100% identical to RF2_MYCBO: Peptide chain release factor 2 (prfB) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K02836, peptide chain release factor 2 (inferred from 100% identity to mra:MRA_3137)

Predicted SEED Role

"Peptide chain release factor 2" in subsystem Programmed frameshift

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>Rv3105c Probable peptide chain release factor 2 PrfB (RF-2) (Mycobacterium tuberculosis H37Rv)
MPVTLAAVDPDRQADIAALDCTLTTVERVLDVEGLRSRIEKLEHEASDPHLWDDQTRAQR
VTSELSHTQGELRRVEELRRRLDDLPVLYELAAEEAGAAAADAVAEADAELKSLRADIEA
TEVRTLLSGEYDEREALVTIRSGAGGVDAADWAEMLMRMYIRWAEQHKYPVEVFDTSYAE
EAGIKSATFAVHAPFAYGTLSVEQGTHRLVRISPFDNQSRRQTSFAEVEVLPVVETTDHI
DIPEGDVRVDVYRSSGPGGQSVNTTDSAVRLTHIPSGIVVTCQNEKSQLQNKIAAMRVLQ
AKLLERKRLEERAELDALKADGGSSWGNQMRSYVLHPYQMVKDLRTEYEVGNPAAVLDGD
LDGFLEAGIRWRNRRNDD