Protein Info for Rv3104c in Mycobacterium tuberculosis H37Rv

Annotation: Possible conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details PF21088: MS_channel_1st" amino acids 89 to 129 (41 residues), 35.8 bits, see alignment 9.3e-13 PF00924: MS_channel_2nd" amino acids 131 to 200 (70 residues), 66.3 bits, see alignment E=3.2e-22 PF21082: MS_channel_3rd" amino acids 207 to 292 (86 residues), 44.9 bits, see alignment E=2e-15

Best Hits

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 100% identity to mtc:MT3187)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>Rv3104c Possible conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
MTTSGTVLATSIAQHWHNFWRGEIGDWILNRGLRIVMLLIAAVLAARFVTWLANRVTRRL
DLGFTESDALVRSEATKHRQAVASVISWVSIVLIYVVVVYEVIDVLPVPVGALVGPAAVL
GAALGFGAQRLVQDLLAGFFIIVEKQYGFGDLVELSMVGSPENAAGTVEDVTLRVTKLRS
SEGEVFTVPNGNIVKSVNLSKDWARAVVDIPVPTSADLGRVNEVLHQECEHARHDSLLGE
LLLDEPTVMGVERIEVDTVTLRLVARTLPGKQFEAGRQLRVLVIRALTRAGIVTAADARA
AVAESPEQ