Protein Info for Rv3088 in Mycobacterium tuberculosis H37Rv

Annotation: Putative triacylglycerol synthase (diacylglycerol acyltransferase) Tgs4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 358 to 376 (19 residues), see Phobius details amino acids 396 to 414 (19 residues), see Phobius details amino acids 419 to 439 (21 residues), see Phobius details TIGR02946: acyltransferase, WS/DGAT/MGAT" amino acids 4 to 461 (458 residues), 451.6 bits, see alignment E=1.6e-139 PF03007: WS_DGAT_cat" amino acids 5 to 273 (269 residues), 279.3 bits, see alignment E=4.1e-87 PF06974: WS_DGAT_C" amino acids 313 to 457 (145 residues), 104.2 bits, see alignment E=6.5e-34

Best Hits

Swiss-Prot: 100% identical to TGS4_MYCTO: Probable diacyglycerol O-acyltransferase Tgs4 (tgs4) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00879)

Predicted SEED Role

"Wax ester synthase/acyl-CoA:diacylglycerol acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>Rv3088 Putative triacylglycerol synthase (diacylglycerol acyltransferase) Tgs4 (Mycobacterium tuberculosis H37Rv)
MTRINPIDLSFLLLERANRPNHMAAYTIFEKPKGQKSSFGPRLFDAYRHSQAAKPFNHKL
KWLGTDVAAWETVEPDMGYHIRHLALPAPGSMQQFHETVSFLNTGLLDRGHPMWECYIID
GIERGRIAILLKVHHALIDGEGGLRAMRNFLSDSPDDTTLAGPWMSAQGADRPRRTPATV
SRRAQLQGQLQGMIKGLTKLPSGLFGVSADAADLGAQALSLKARKASLPFTARRTLFNNT
AKSAARAYGNVELPLADVKALAKATGTSVNDVVMTVIDDALHHYLAEHQASTDRPLVAFM
PMSLREKSGEGGGNRVSAELVPMGAPKASPVERLKEINAATTRAKDKGRGMQTTSRQAYA
LLLLGSLTVADALPLLGKLPSANVVISNMKGPTEQLYLAGAPLVAFSGLPIVPPGAGLNV
TFASINTALCIAIGAAPEAVHEPSRLAELMQRAFTELQTEAGTTSPTTSKSRTP