Protein Info for Rv3079c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 transmembrane" amino acids 64 to 86 (23 residues), see Phobius details TIGR03619: probable F420-dependent oxidoreductase, Rv2161c family" amino acids 18 to 251 (234 residues), 259.8 bits, see alignment E=1.4e-81 PF00296: Bac_luciferase" amino acids 18 to 218 (201 residues), 132.9 bits, see alignment E=8.2e-43

Best Hits

Swiss-Prot: 43% identical to Y978_MYCBO: Uncharacterized protein Mb0978c (BQ2027_MB0978C) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mtu:Rv3079c)

Predicted SEED Role

"Hydride transferase 1 (Fragment)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (275 amino acids)

>Rv3079c Conserved protein (Mycobacterium tuberculosis H37Rv)
MQFGVLTFVTDEGIGPAELGAALEHRGFESLFLAEHTHIPVNTQSPYPGGGPIPEKYYRT
LDPFVALAAAAATTQSLVLGTGIALIPERDPIVTAKEVASLDLVSQGRFRFGVGVGWLRE
EVANHGVDPAVRGRVIDERLRAIIEIWTQEQAEFHGTYVDFDPIYCWPKPVTKPYPPLYV
GGGPANFPRIARLNAGWIAISPSPQRLSGPLQRLRAMAGGDVPVTVCQWGEAAAKDLEGY
RHLGVERVLLELPTEPRDPTLRYLDKLQAELARLA