Protein Info for Rv3063 in Mycobacterium tuberculosis H37Rv

Annotation: Probable carbon starvation protein A homolog CstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 758 transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 195 to 220 (26 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 285 to 311 (27 residues), see Phobius details amino acids 323 to 340 (18 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 398 to 421 (24 residues), see Phobius details amino acids 504 to 523 (20 residues), see Phobius details amino acids 554 to 574 (21 residues), see Phobius details amino acids 585 to 608 (24 residues), see Phobius details amino acids 615 to 635 (21 residues), see Phobius details amino acids 686 to 707 (22 residues), see Phobius details PF02554: CstA" amino acids 67 to 443 (377 residues), 551.8 bits, see alignment E=7.7e-170 PF13722: CstA_5TM" amino acids 503 to 633 (131 residues), 129.2 bits, see alignment E=1.1e-41

Best Hits

Swiss-Prot: 100% identical to CSTA_MYCTU: Peptide transporter CstA (cstA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K06200, carbon starvation protein (inferred from 100% identity to mra:MRA_3095)

Predicted SEED Role

"Carbon starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (758 amino acids)

>Rv3063 Probable carbon starvation protein A homolog CstA (Mycobacterium tuberculosis H37Rv)
VAAPTPSNRIEERSGHASCVRADADLPPVAILGRSPITLRHKIFFVAVAVIGALAWTVVA
FFRNEPVNAVWIVVAAGCTYIIGFRFYARLIEMKVVRPRDDHATPAEILDDGTDYVPTDR
RVVFGHHFAAIAGAGPLVGPVLATQMGYLPSSIWIVVGAVLAGCVQDYLVLWISVRRRGR
SLGQMVRDELGATAGVAALVGIPVIITIVIAVLALVVVRALAKSPWGVFSIAMTIPIAIF
MGCYLRFLRPGRVSEVSLIGIGLLLLAVVSGDWVAHTSWGAAWFSLSPVTLCWLLISYGF
AASVLPVWLLLAPRDYLSTFMKVGTIALLAIGVCAAHPIIEAPAVSKFAGSGNGPVFAGS
LFPFLFITIACGALSGFHALICSGTTPKMLEKEGQMRVIGYGGMMTESFVAVIALLTAAI
LDQHLYFTLNAPSLHTHDSAATAAKYVNGLGLTGSPVTPDHISQAAASVGEQTIVSRTGG
APTLAFGMAEMLHRVVGGVGLKAFWYHFAIMFEALFILTTVDAGTRAARFMISDALGNFG
GVLRKLQNPSWRPGAWACRLVVVAAWGSILLLGVTDPLGGINTLFPLFGIANQLLAGIAL
TVITVVVIKKGRLKWAWIPGIPLLWDLAVTLTASWQKIFSADPSVGYWTQHAHYAAAQHA
GETAFGSATNADEINDVVRNTFVQGTLSIVFVVVVVLVVVAGVIVALKTIRGRGIPLAED
DPAPSTLFAPAGLIPTAAERKLQRRLGAPASASVAAPD