Protein Info for Rv3043c in Mycobacterium tuberculosis H37Rv

Annotation: Probable cytochrome C oxidase polypeptide I CtaD (cytochrome AA3 subunit 1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 transmembrane" amino acids 40 to 62 (23 residues), see Phobius details amino acids 83 to 109 (27 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 171 to 196 (26 residues), see Phobius details amino acids 208 to 234 (27 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details amino acids 430 to 452 (23 residues), see Phobius details amino acids 472 to 493 (22 residues), see Phobius details TIGR02891: cytochrome c oxidase, subunit I" amino acids 32 to 535 (504 residues), 711.5 bits, see alignment E=2.8e-218 PF00115: COX1" amino acids 40 to 483 (444 residues), 542.6 bits, see alignment E=3.5e-167

Best Hits

Swiss-Prot: 100% identical to COX1_MYCBO: Probable cytochrome c oxidase subunit 1 (ctaD) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 100% identity to mtf:TBFG_13059)

MetaCyc: 48% identical to cytochrome caa3 oxidase (subunit I) (Bacillus subtilis subtilis 168)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase polypeptide I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (573 amino acids)

>Rv3043c Probable cytochrome C oxidase polypeptide I CtaD (cytochrome AA3 subunit 1) (Mycobacterium tuberculosis H37Rv)
LTAEAPPLGELEAIRPYPARTGPKGSLVYKLITTTDHKMIGIMYCVACISFFFIGGLLAL
LMRTELAAPGLQFLSNEQFNQLFTMHGTIMLLFYATPIVFGFANLVLPLQIGAPDVAFPR
LNAFSFWLFVFGATIGAAGFITPGGAADFGWTAYTPLTDAIHSPGAGGDLWIMGLIVAGL
GTILGAVNMITTVVCMRAPGMTMFRMPIFTWNIMVTSILILIAFPLLTAALFGLAADRHL
GAHIYDAANGGVLLWQHLFWFFGHPEVYIIALPFFGIVSEIFPVFSRKPIFGYTTLVYAT
LSIAALSVAVWAHHMFATGAVLLPFFSFMTYLIAVPTGIKFFNWIGTMWKGQLTFETPML
FSVGFMVTFLLGGLTGVLLASPPLDFHVTDSYFVVAHFHYVLFGTIVFATFAGIYFWFPK
MTGRLLDERLGKLHFWLTFIGFHTTFLVQHWLGDEGMPRRYADYLPTDGFQGLNVVSTIG
AFILGASMFPFVWNVFKSWRYGEVVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSER
PAFELHYPHMVERLRAEAHVGRHHDEPAMVTSS