Protein Info for Rv3041c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved ATP-binding protein ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF00005: ABC_tran" amino acids 40 to 188 (149 residues), 88.1 bits, see alignment E=8.5e-29 PF13304: AAA_21" amino acids 147 to 223 (77 residues), 27.1 bits, see alignment E=4.1e-10

Best Hits

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to mra:MRA_3073)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>Rv3041c Probable conserved ATP-binding protein ABC transporter (Mycobacterium tuberculosis H37Rv)
MRHDSRVLDNGGPDAADPDLLIDFRNVSLRRNGRTLVGPLDWAVELDERWVIVGPNGAGK
TSLLRIAAAAEHPSSGVAFVLGERLGRVDVSELRARVGLSSSALAERVPGDERVRDLVVS
AGYAVLGRWRERYEAVDYHRAIDMLESLGAEHLANRTYGTLSEGERKRVLIARALMTDPE
LLLLDEPAAGLDLGGREELVARLADLAADPDAPALVLVTHHVEEIPPGFSHCLLLSEARV
VAAGLLPDALTAENLSTAFGQEITLEVADGRYFARRRRSRAAHRRQS