Protein Info for Rv3038c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF01209: Ubie_methyltran" amino acids 74 to 178 (105 residues), 45.3 bits, see alignment E=2.1e-15 PF13489: Methyltransf_23" amino acids 79 to 213 (135 residues), 45.7 bits, see alignment E=1.8e-15 PF13847: Methyltransf_31" amino acids 80 to 179 (100 residues), 64.7 bits, see alignment E=2.5e-21 PF08241: Methyltransf_11" amino acids 82 to 179 (98 residues), 83.7 bits, see alignment E=3.5e-27 PF08242: Methyltransf_12" amino acids 82 to 177 (96 residues), 54.3 bits, see alignment E=5.5e-18 PF13649: Methyltransf_25" amino acids 82 to 175 (94 residues), 74 bits, see alignment E=4e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to mbo:Mb3064c)

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>Rv3038c Conserved protein (Mycobacterium tuberculosis H37Rv)
MTRSSNIPADATPNPHATAEQVAAARHDSKLAQVLYHDWEAENYDEKWSISYDQRCVDYA
RGRFDAIVPDEVIAQLPYDRALELGCGTGFFLLNLIQAGVARRGSVTDLSPGMVKVATRN
GQALGLDIDGRVADAEGIPYDDDAFDLVVGHAVLHHIPDVELSLREVVRVLKPGGRFVFA
GEPTTVGDGYARTLSTLTWRVVTNATKLPGLRGWRRPQGELDESSRAAALEALVDLHTFT
PQDLQRIAHNAGAVEVQTATEEFTAAMLGWPLRTFECTVPPGRLGWGWARFAFTSWKTLG
WVDANVWRHVVPKGWFYNVMITGVKPS