Protein Info for Rv3032 in Mycobacterium tuberculosis H37Rv

Annotation: Alpha (1->4) glucosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF08323: Glyco_transf_5" amino acids 2 to 192 (191 residues), 88.7 bits, see alignment E=1.8e-28 PF13439: Glyco_transf_4" amino acids 15 to 204 (190 residues), 100.6 bits, see alignment E=3.6e-32 PF13579: Glyco_trans_4_4" amino acids 16 to 199 (184 residues), 94.7 bits, see alignment E=2.6e-30 PF20706: GT4-conflict" amino acids 16 to 384 (369 residues), 91.8 bits, see alignment E=1.7e-29 PF00534: Glycos_transf_1" amino acids 212 to 372 (161 residues), 155.4 bits, see alignment E=3.7e-49 PF13692: Glyco_trans_1_4" amino acids 218 to 358 (141 residues), 106.3 bits, see alignment E=5.8e-34 PF13524: Glyco_trans_1_2" amino acids 299 to 384 (86 residues), 46 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 100% identical to GLGSY_MYCTU: Glycogen synthase (Rv3032) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_13048)

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>Rv3032 Alpha (1->4) glucosyltransferase (Mycobacterium tuberculosis H37Rv)
MRILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRCPSGTDPSTHPSSDEVTEG
VRVIAAAQDPHEFTFGNDMMAWTLAMGHAMIRAGLRLKKLGTDRSWRPDVVHAHDWLVAH
PAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSASMND
EITELFGPGLAEITVIRNGIDAARWPFAARRPRTGPAELLYVGRLEYEKGVHDAIAALPR
LRRTHPGTTLTIAGEGTQQDWLIDQARKHRVLRATRFVGHLDHTELLALLHRADAAVLPS
HYEPFGLVALEAAAAGTPLVTSNIGGLGEAVINGQTGVSCAPRDVAGLAAAVRSVLDDPA
AAQRRARAARQRLTSDFDWQTVATATAQVYLAAKRGERQPQPRLPIVEHALPDR