Protein Info for Rv3031 in Mycobacterium tuberculosis H37Rv

Annotation: Conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 transmembrane" amino acids 37 to 55 (19 residues), see Phobius details PF03065: Glyco_hydro_57" amino acids 13 to 244 (232 residues), 43.4 bits, see alignment E=2.9e-15 PF09210: BE_C" amino acids 444 to 522 (79 residues), 65.7 bits, see alignment E=4.2e-22

Best Hits

Swiss-Prot: 100% identical to BE_MYCTO: Probable 1,4-alpha-glucan branching enzyme MT3115 (MT3115) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mra:MRA_3062)

Predicted SEED Role

"Glycogen branching enzyme, GH-57-type, archaeal (EC 2.4.1.18)" in subsystem Glycogen metabolism (EC 2.4.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.18

Use Curated BLAST to search for 2.4.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (526 amino acids)

>Rv3031 Conserved protein (Mycobacterium tuberculosis H37Rv)
LNTSASPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLQVLAALADENRH
RLITLGMTPVVNAQLDDPYCLNGVHHWLANWQLRAEEAASVRYARQSKSADYPSCTPEAL
RAFGIRECADAARALDNFATRWRHGGSPLLRGLIDAGTVELLGGPLAHPFQPLLAPRLRE
FALREGLADAQLRLAHRPKGIWAPECAYAPGMEVDYATAGVSHFMVDGPSLHGDTALGRP
VGKTDVVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGRNVPSEQKA
PYDPERADRAVDVHVADFVDVVRNRLLSESERIGRPAHVIAAFDTELFGHWWYEGPTWLQ
RVLRALPAAGVRVGTLSDAIADGFVGDPVELPPSSWGSGKDWQVWSGAKVADLVQLNSEV
VDTALTTIDKALAQTASLDGPLPRDHVADQILRETLLTVSSDWPFMVSKDSAADYARYRA
HLHAHATREIAGALAAGRRDTARRLAEGWNRADGLFGALDARRLPK