Protein Info for Rv3029c in Mycobacterium tuberculosis H37Rv

Annotation: Probable electron transfer flavoprotein (beta-subunit) FixA (beta-ETF) (electron transfer flavoprotein small subunit) (ETFSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF01012: ETF" amino acids 25 to 214 (190 residues), 124.4 bits, see alignment E=2.3e-40

Best Hits

Swiss-Prot: 100% identical to ETFB_MYCTO: Electron transfer flavoprotein subunit beta (etfB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03521, electron transfer flavoprotein beta subunit (inferred from 100% identity to mbb:BCG_3052c)

MetaCyc: 36% identical to electron transfer protein beta subunit (Clostridium kluyveri)
RXN-16834 [EC: 1.3.1.109]

Predicted SEED Role

"Electron transfer flavoprotein, beta subunit" in subsystem Acetyl-CoA fermentation to Butyrate

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.109

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>Rv3029c Probable electron transfer flavoprotein (beta-subunit) FixA (beta-ETF) (electron transfer flavoprotein small subunit) (ETFSS) (Mycobacterium tuberculosis H37Rv)
MTNIVVLIKQVPDTWSERKLTDGDFTLDREAADAVLDEINERAVEEALQIREKEAADGIE
GSVTVLTAGPERATEAIRKALSMGADKAVHLKDDGMHGSDVIQTGWALARALGTIEGTEL
VIAGNESTDGVGGAVPAIIAEYLGLPQLTHLRKVSIEGGKITGERETDEGVFTLEATLPA
VISVNEKINEPRFPSFKGIMAAKKKEVTVLTLAEIGVESDEVGLANAGSTVLASTPKPAK
TAGEKVTDEGEGGNQIVQYLVAQKII