Protein Info for Rv3028c in Mycobacterium tuberculosis H37Rv

Annotation: Probable electron transfer flavoprotein (alpha-subunit) FixB (alpha-ETF) (electron transfer flavoprotein large subunit) (ETFLS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01012: ETF
  • amino acids 4 to 174 (171 residues), 103.9 bits, E=9.5e-34
• PF00766: ETF_alpha
  • amino acids 194 to 274 (81 residues), 119.2 bits, E=5.9e-39

Best Hits

Swiss-Prot: 100% identical to ETFA_MYCTU: Electron transfer flavoprotein subunit alpha (etfA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K03522, electron transfer flavoprotein alpha subunit (inferred from 100% identity to mbb:BCG_3051c)

Predicted SEED Role

"Electron transfer flavoprotein, alpha subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Protein Sequence (318 amino acids)

>Rv3028c Probable electron transfer flavoprotein (alpha-subunit) FixB (alpha-ETF) (electron transfer flavoprotein large subunit) (ETFLS) (Mycobacterium tuberculosis H37Rv)
MAEVLVLVEHAEGALKKVSAELITAARALGEPAAVVVGVPGTAAPLVDGLKAAGAAKIYV
AESDLVDKYLITPAVDVLAGLAESSAPAGVLIAATADGKEIAGRLAARIGSGLLVDVVDV
REGGVGVHSIFGGAFTVEAQANGDTPVITVRAGAVEAEPAAGAGEQVSVEVPAAAENAAR
ITAREPAVAGDRPELTEATIVVAGGRGVGSAENFSVVEALADSLGAAVGASRAAVDSGYY
PGQFQVGQTGKTVSPQLYIALGISGAIQHRAGMQTSKTIVAVNKDEEAPIFEIADYGVVG
DLFKVAPQLTEAIKARKG