Protein Info for Rv2997 in Mycobacterium tuberculosis H37Rv

Annotation: Possible alanine rich dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12831: FAD_oxidored
  • amino acids 2 to 41 (40 residues), 28.3 bits, 2.3e-10
• PF13450: NAD_binding_8
  • amino acids 5 to 58 (54 residues), 35 bits, 2.9e-12

Best Hits

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to mbb:BCG_3018)

Predicted SEED Role

"Phytoene dehydrogenase and related proteins" in subsystem Carotenoids

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Protein Sequence (480 amino acids)

>Rv2997 Possible alanine rich dehydrogenase (Mycobacterium tuberculosis H37Rv)
VDVTVVGSGPNGLATAVICARAGLNVQVVEAQATFGGGARSAADFEFPEVLHDVCSAVHP
LALASPFFAEFDLPARGVTLTVPDIAYANPLPGRPAAIAYHDLAHTCAKLDDGASWRRLL
GPLVAHSETVVEFMLSDKRSLPTALGSVLRLGLRMLAQGTPAWRSLAGEDARALFTGVAA
HAISPLPSLVSAGAGLMLATLAHSVGWPIPVGGTQAIADALIADLRAHGGRLAAGVEITE
PQRSVVVFDTAPTALLRVYRDKLPHRYAKALRRYRFRAGIAKVDFVLSDEIPWSDPRLRR
AATLHLGGTRDQMARAEADVAAGRHADWPMVLAACPHVADPGRIDETGRRPFWTYAHVPS
GSTLDATETVTSVLERFAPGFRDIVVAARAVPAARMADHNANYVGGDITVGANSTWRAIA
GPTPRLNPWRTPIPKVYLCSAATPPGAGVHGMCGWYAARTLLRTEFGITRMPPLGHELRP