Protein Info for Rv2996c in Mycobacterium tuberculosis H37Rv

Annotation: Probable D-3-phosphoglycerate dehydrogenase SerA1 (PGDH)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 TIGR01327: phosphoglycerate dehydrogenase" amino acids 6 to 527 (522 residues), 688 bits, see alignment E=4.7e-211 PF00389: 2-Hacid_dh" amino acids 6 to 313 (308 residues), 131.7 bits, see alignment E=3.7e-42 PF02826: 2-Hacid_dh_C" amino acids 107 to 281 (175 residues), 208.9 bits, see alignment E=1e-65 PF03446: NAD_binding_2" amino acids 143 to 231 (89 residues), 23.1 bits, see alignment E=1.7e-08 PF19304: PGDH_inter" amino acids 323 to 443 (121 residues), 63.7 bits, see alignment E=4.4e-21 PF01842: ACT" amino acids 456 to 516 (61 residues), 36 bits, see alignment E=1.2e-12

Best Hits

Swiss-Prot: 100% identical to SERA_MYCTO: D-3-phosphoglycerate dehydrogenase (serA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00058, D-3-phosphoglycerate dehydrogenase [EC: 1.1.1.95] (inferred from 100% identity to mtc:MT3074)

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.95

Use Curated BLAST to search for 1.1.1.95

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (528 amino acids)

>Rv2996c Probable D-3-phosphoglycerate dehydrogenase SerA1 (PGDH) (Mycobacterium tuberculosis H37Rv)
VSLPVVLIADKLAPSTVAALGDQVEVRWVDGPDRDKLLAAVPEADALLVRSATTVDAEVL
AAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIPAA
DASLREHTWKRSSFSGTEIFGKTVGVVGLGRIGQLVAQRIAAFGAYVVAYDPYVSPARAA
QLGIELLSLDDLLARADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAA
LADAITGGHVRAAGLDVFATEPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVR
LALAGEFVPDAVNVGGGVVNEEVAPWLDLVRKLGVLAGVLSDELPVSLSVQVRGELAAEE
VEVLRLSALRGLFSAVIEDAVTFVNAPALAAERGVTAEICKASESPNHRSVVDVRAVGAD
GSVVTVSGTLYGPQLSQKIVQINGRHFDLRAQGINLIIHYVDRPGALGKIGTLLGTAGVN
IQAAQLSEDAEGPGATILLRLDQDVPDDVRTAIAAAVDAYKLEVVDLS