Protein Info for Rv2994 in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 146 to 155 (10 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 216 to 239 (24 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 356 (336 residues), 167.5 bits, see alignment E=2.1e-53

Best Hits

Swiss-Prot: 100% identical to Y2994_MYCTU: Uncharacterized MFS-type transporter Rv2994 (Rv2994) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to mtc:MT3072)

Predicted SEED Role

"Integral membrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>Rv2994 Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
MSRDPTGVGARWAIMIVSLGVTASSFLFINGVAFLIPRLENARGTPLSHAGLLASMPSWG
LVVTMFAWGYLLDHVGERMVMAVGSALTAAAAYAAASVHSLLWIGVFLFLGGMAAGGCNS
AGGRLVSGWFPPQQRGLAMGIRQTAQPLGIASGALVIPELAERGVHAGLMFPAVVCTLAA
VASVLGIVDPPRKSRTKASEQELASPYRGSSILWRIHAASALLMMPQTVTVTFMLVWLIN
HHGWSVAQAGVLVTISQLLGALGRVAVGRWSDHVGSRMRPVRLIAAAAAATLFLLAAVDN
EGSRYDVLLMIAISVIAVLDNGLEATAITEYAGPYWSGRALGIQNTTQRLMAAAGPPLFG
SLITTAAYPTAWALCGVFPLAAVPLVPVRLLPPGLETRARRQSVRRHRWWQAVRCHAWPN
GPRRPGPPGQPRRVRQGGTAITPPT