Protein Info for Rv2993c in Mycobacterium tuberculosis H37Rv

Annotation: Possible 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (HHDD isomerase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF10370: Rv2993c-like_N" amino acids 2 to 31 (30 residues), 39.4 bits, see alignment 8.9e-14 PF01557: FAA_hydrolase" amino acids 36 to 234 (199 residues), 247.5 bits, see alignment E=1.2e-77

Best Hits

Swiss-Prot: 49% identical to Y2225_ARCFU: Uncharacterized protein AF_2225 (AF_2225) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_00976)

Predicted SEED Role

"2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (EC 5.3.3.-) / 5-carboxymethyl-2-oxo-hex-3- ene-1,7-dioate decarboxylase (EC 4.1.1.68)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation (EC 4.1.1.68, EC 5.3.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.3.-

Use Curated BLAST to search for 4.1.1.68 or 5.3.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>Rv2993c Possible 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase (HHDD isomerase) (Mycobacterium tuberculosis H37Rv)
MTAREIAEHPFGTPTFTGRSWPLADVRLLAPILASKVVCVGKNYADHIAEMGGRPPADPV
IFLKPNTAIIGPNTPIRLPANASPVHFEGELAIVIGRACKDVPAAQAVDNILGYTIGNDV
SARDQQQSDGQWTRAKGHDTFCPVGPWIVTDLAPFDPADLELRTVVNGDVKQHARTSLMI
HDIGAIVEWISAIMTLLPGDLILTGTPAGVGPIEDGDTVSITIEGIGTLTNPVVRKGKP