Protein Info for Rv2977c in Mycobacterium tuberculosis H37Rv

Annotation: Probable thiamine-monophosphate kinase ThiL (thiamine-phosphate kinase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR01379: thiamine-phosphate kinase" amino acids 19 to 323 (305 residues), 306.4 bits, see alignment E=9.9e-96 PF00586: AIRS" amino acids 42 to 152 (111 residues), 77.9 bits, see alignment E=8e-26 PF02769: AIRS_C" amino acids 166 to 250 (85 residues), 25 bits, see alignment E=1.8e-09

Best Hits

Swiss-Prot: 100% identical to THIL_MYCTO: Thiamine-monophosphate kinase (thiL) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 99% identity to mtb:TBMG_00992)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>Rv2977c Probable thiamine-monophosphate kinase ThiL (thiamine-phosphate kinase) (Mycobacterium tuberculosis H37Rv)
VTTKDHSLATESPTLQQLGEFAVIDRLVRGRRQPATVLLGPGDDAALVSAGDGRTVVSTD
MLVQDSHFRLDWSTPQDVGRKAIAQNAADIEAMGARATAFVVGFGAPAETPAAQASALVD
GMWEEAGRIGAGIVGGDLVSCRQWVVSVTAIGDLDGRAPVLRSGAKAGSVLAVVGELGRS
AAGYALWCNGIEDFAELRRRHLVPQPPYGHGAAAAAVGAQAMIDVSDGLLADLRHIAEAS
GVRIDLSAAALAADRDALTAAATALGTDPWPWVLSGGEDHALVACFVGPVPAGWRTIGRV
LDGPARVLVDGEEWTGYAGWQSFGEPDNQGSLG