Protein Info for Rv2964 in Mycobacterium tuberculosis H37Rv

Annotation: Probable formyltetrahydrofolate deformylase PurU (formyl-FH(4) hydrolase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00655: formyltetrahydrofolate deformylase
  • amino acids 32 to 310 (279 residues), 429.5 bits, E=3.5e-133
• PF01842: ACT
  • amino acids 33 to 92 (60 residues), 41.1 bits, E=1.2e-14
• PF00551: Formyl_trans_N
  • amino acids 116 to 292 (177 residues), 131.8 bits, E=2.5e-42

Best Hits

Swiss-Prot: 100% identical to PURU_MYCTU: Formyltetrahydrofolate deformylase (purU) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 100% identity to mtc:MT3041)

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

• formaldehyde oxidation VII (THF pathway) (4/4 steps found)
• folate transformations I (6/13 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Protein Sequence (310 amino acids)

>Rv2964 Probable formyltetrahydrofolate deformylase PurU (formyl-FH(4) hydrolase) (Mycobacterium tuberculosis H37Rv)
MGKGSMTAHATPNEPDYPPPPGGPPPPADIGRLLLRCHDRPGIIAAVSTFLARAGANIIS
LDQHSTAPEGGTFLQRAIFHLPGLTAAVDELQRDFGSTVADKFGIDYRFAEAAKPKRVAI
MASTEDHCLLDLLWRNRRGELEMSVVMVIANHPDLAAHVRPFGVPFIHIPATRDTRTEAE
QRQLQLLSGNVDLVVLARYMQILSPGFLEAIGCPLINIHHSFLPAFTGAAPYQRARERGV
KLIGATAHYVTEVLDEGPIIEQDVVRVDHTHTVDDLVRVGADVERAVLSRAVLWHCQDRV
IVHHNQTIVF