Protein Info for Rv2952 in Mycobacterium tuberculosis H37Rv

Annotation: Possible methyltransferase (methylase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13489: Methyltransf_23
  • amino acids 71 to 183 (113 residues), 30.2 bits, E=1.2e-10
• PF01209: Ubie_methyltran
  • amino acids 77 to 178 (102 residues), 38.2 bits, E=3.8e-13
• PF13847: Methyltransf_31
  • amino acids 81 to 197 (117 residues), 59.1 bits, E=1.6e-19
• PF13649: Methyltransf_25
  • amino acids 84 to 176 (93 residues), 73.9 bits, E=4.9e-24
• PF08242: Methyltransf_12
  • amino acids 85 to 178 (94 residues), 50.7 bits, E=8.7e-17
• PF08241: Methyltransf_11
  • amino acids 85 to 178 (94 residues), 84.6 bits, E=2.1e-27

Best Hits

Swiss-Prot: 100% identical to PHMT_MYCBP: Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase (BCG_2973) from Mycobacterium bovis (strain BCG / Pasteur 1173P2)

KEGG orthology group: K00599, [EC: 2.1.1.-] (inferred from 100% identity to mbo:Mb2976)

MetaCyc: 100% identical to (phenol)phthiotriol methyltransferase (Mycobacterium tuberculosis variant bovis)
2.1.1.M12 [EC: 2.1.1.M12]; 2.1.1.M12 [EC: 2.1.1.M12]; 2.1.1.M12 [EC: 2.1.1.M12]; 2.1.1.M12 [EC: 2.1.1.M12]

Predicted SEED Role

"methyltransferase, putative"

MetaCyc Pathways

• phthiocerol biosynthesis (5/8 steps found)
• phenolphthiocerol biosynthesis (7/23 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.M12

Protein Sequence (270 amino acids)

>Rv2952 Possible methyltransferase (methylase) (Mycobacterium tuberculosis H37Rv)
MAFSRTHSLLARAGSTSTYKRVWRYWYPLMTRGLGNDEIVFINWAYEEDPPMDLPLEASD
EPNRAHINLYHRTATQVDLGGKQVLEVSCGHGGGASYLTRTLHPASYTGLDLNQAGIKLC
KKRHRLPGLDFVRGDAENLPFDDESFDVVLNVEASHCYPHFRRFLAEVVRVLRPGGYFPY
ADLRPNNEIAAWEADLAATPLRQLSQRQINAEVLRGIGNNSQKSRDLVDRHLPAFLRFAG
REFIGVQGTQLSRYLEGGELSYRMYCFTKD