Protein Info for Rv2947c in Mycobacterium tuberculosis H37Rv

Annotation: Probable polyketide synthase Pks15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 transmembrane" amino acids 237 to 255 (19 residues), see Phobius details PF00109: ketoacyl-synt" amino acids 47 to 294 (248 residues), 330.7 bits, see alignment E=1.4e-102 PF00108: Thiolase_N" amino acids 206 to 248 (43 residues), 27.7 bits, see alignment 3.7e-10 PF02801: Ketoacyl-synt_C" amino acids 302 to 419 (118 residues), 151.4 bits, see alignment E=2.2e-48 PF16197: KAsynt_C_assoc" amino acids 422 to 477 (56 residues), 37.9 bits, see alignment 4.3e-13

Best Hits

Swiss-Prot: 100% identical to PKS15_MYCTU: Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 (pks15) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K12430, polyketide synthase 1/15 (inferred from 100% identity to mtc:MT3021.1)

Predicted SEED Role

"(MTCY24G1.02), len: 496 aa, Probable polyketide synthase, almost identical to G560508 PKS002B (495 aa), fasta scores, opt: 3270, E(): 0, (99.6% identity in 496 aa overlap); contains PS00606 Beta-ketoacyl synthases active site; similar to MTCY338.20 (49.9% identity in 465 aa overlap) and MTCY24G1.09 (50.2% identity in 454 aa overlap) and MTCY22H8.03 (47.6% identity in 437 aa overlap)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (496 amino acids)

>Rv2947c Probable polyketide synthase Pks15 (Mycobacterium tuberculosis H37Rv)
VIEEQRTMSVEGADQQSEKLFHYLKKVAVELDETRARLREYEQRATEPVAVVGIGCRFPG
GVDGPDGLWDVVSAGRDVVSEFPTDRGWDVEGLYDPDPDAEGKTYTRWGAFLDDATGFDA
GFFGIAPSEVLAMDPQQRLMLEVSWEALEHAGIDPLSLRGSATGVYTGIFAASYGNRDTG
GLQGYGLTGTSISVASGRVSYVLGLQGPAVSVDTACSSSLVAIHWAMSSLRSGECDLALA
GGVTVMGLPSIFVGFSRQRGLAADGRCKAFAAAADGTGWGEGAGVVVLERLSDARRLGHS
VLAVVRGSAVNQDGASNGLTAPNGLAQQRVIQVALANAGLSAADVDVVEAHGTATTLGDP
IEAQALLSTYGQGGPAEQPLWVGSIKSNMGHTQAAAGVAGVIKMVQAMRHGVMPATLHVD
EPSPRVDWTSGAVSVLTEAREWSVDGRPRRAAVSSFGISGTNAHLILEEAPVPAPAEAPV
EASESTGGRGRRWCRG