Protein Info for Rv2941 in Mycobacterium tuberculosis H37Rv

Annotation: Fatty-acid-AMP ligase FadD28 (fatty-acid-AMP synthetase) (fatty-acid-AMP synthase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 transmembrane" amino acids 226 to 240 (15 residues), see Phobius details PF00501: AMP-binding" amino acids 13 to 415 (403 residues), 184.2 bits, see alignment E=1.8e-58

Best Hits

Swiss-Prot: 100% identical to FAA28_MYCTO: Long-chain-fatty-acid--AMP ligase FadD28 (fadD28) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K12427, fatty acid CoA ligase FadD28 (inferred from 100% identity to mbt:JTY_2958)

MetaCyc: 100% identical to long-chain fatty acid adenylyltransferase FadD28 (Mycobacterium tuberculosis variant bovis)
RXN-18531 [EC: 6.2.1.49]

Predicted SEED Role

"Long-chain fatty-acid-AMP ligase, Mycobacterial subgroup FadD28"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (580 amino acids)

>Rv2941 Fatty-acid-AMP ligase FadD28 (fatty-acid-AMP synthetase) (fatty-acid-AMP synthase) (Mycobacterium tuberculosis H37Rv)
MSVRSLPAALRACARLQPHDPAFTFMDYEQDWDGVAITLTWSQLYRRTLNVAQELSRCGS
TGDRVVISAPQGLEYVVAFLGALQAGRIAVPLSVPQGGVTDERSDSVLSDSSPVAILTTS
SAVDDVVQHVARRPGESPPSIIEVDLLDLDAPNGYTFKEDEYPSTAYLQYTSGSTRTPAG
VVMSHQNVRVNFEQLMSGYFADTDGIPPPNSALVSWLPFYHDMGLVIGICAPILGGYPAV
LTSPVSFLQRPARWMHLMASDFHAFSAAPNFAFELAARRTTDDDMAGRDLGNILTILSGS
ERVQAATIKRFADRFARFNLQERVIRPSYGLAEATVYVATSKPGQPPETVDFDTESLSAG
HAKPCAGGGATSLISYMLPRSPIVRIVDSDTCIECPDGTVGEIWVHGDNVANGYWQKPDE
SERTFGGKIVTPSPGTPEGPWLRTGDSGFVTDGKMFIIGRIKDLLIVYGRNHSPDDIEAT
IQEITRGRCAAISVPGDRSTEKLVAIIELKKRGDSDQDAMARLGAIKREVTSALSSSHGL
SVADLVLVAPGSIPITTSGKVRRGACVEQYRQDQFARLDA