Protein Info for Rv2938 in Mycobacterium tuberculosis H37Rv

Annotation: Probable daunorubicin-dim-transport integral membrane protein ABC transporter DrrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 45 to 70 (26 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 125 to 127 (3 residues), see Phobius details amino acids 129 to 154 (26 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 245 to 245 (1 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details PF01061: ABC2_membrane" amino acids 31 to 237 (207 residues), 44.9 bits, see alignment E=1e-15 TIGR00025: ABC transporter efflux protein, DrrB family" amino acids 46 to 274 (229 residues), 304 bits, see alignment E=7.3e-95 PF12698: ABC2_membrane_3" amino acids 80 to 262 (183 residues), 33.5 bits, see alignment E=2.5e-12 TIGR01248: daunorubicin resistance protein C" amino acids 91 to 242 (152 residues), 225.2 bits, see alignment E=4e-71

Best Hits

Swiss-Prot: 100% identical to DRRC_MYCTU: Probable doxorubicin resistance ABC transporter permease protein DrrC (drrC) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to mra:MRA_2964)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (276 amino acids)

>Rv2938 Probable daunorubicin-dim-transport integral membrane protein ABC transporter DrrC (Mycobacterium tuberculosis H37Rv)
MITTTSQEIELAPTRLPGSQNAARLFVAQTLLQTNRLLTRWARDYITVIGAIVLPILFMV
VLNIVLGNLAYVVTHDSGLYSIVPLIALGAAITGSTFVAIDLMRERSFGLLARLWVLPVH
RASGLISRILANAIRTLVTTLVMLGTGVVLGFRFRQGLIPSLMWISVPVILGIAIAAMVT
TVALYTAQTVVVEGVELVQAIAIFFSTGLVPLNSYPGWIQPFVAHQPVSYAIAAMRGFAM
GGPVLSPMIGMLVWTAGICVVCAVPLAIGYRRASTH