Protein Info for Rv2937 in Mycobacterium tuberculosis H37Rv

Annotation: Daunorubicin-dim-transport integral membrane protein ABC transporter DrrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 45 to 69 (25 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 133 to 159 (27 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 199 to 221 (23 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details TIGR00025: ABC transporter efflux protein, DrrB family" amino acids 50 to 289 (240 residues), 338 bits, see alignment E=1.5e-105 PF12698: ABC2_membrane_3" amino acids 80 to 278 (199 residues), 35 bits, see alignment E=4.5e-13

Best Hits

Swiss-Prot: 100% identical to DRRB_MYCTU: Doxorubicin resistance ABC transporter permease protein DrrB (drrB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to mra:MRA_2963)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>Rv2937 Daunorubicin-dim-transport integral membrane protein ABC transporter DrrB (Mycobacterium tuberculosis H37Rv)
MSGPAIDASPALTFNQSSASIQQRRLSTGRQMWVLYRRFAAPSLLNGEVLTTVGAPIIFM
VGFYIPFAIPWNQFVGGASSGVASNLGQYITPLVTLQAVSFAAIGSGFRAATDSLLGVNR
RFQSMPMAPLTPLLARVWVAVDRCFTGLVISLVCGYVIGFRFHRGALYIVGFCLLVIAIG
AVLSFAADLVGTVTRNPDAMLPLLSLPILIFGLLSIGLMPLKLFPHWIHPFVRNQPISQF
VAALRALAGDTTKTASQVSWPVMAPTLTWLFAFVVILALSSTIVLARRP