Protein Info for Rv2936 in Mycobacterium tuberculosis H37Rv

Annotation: Daunorubicin-dim-transport ATP-binding protein ABC transporter DrrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR01188: daunorubicin resistance ABC transporter, ATP-binding protein" amino acids 15 to 316 (302 residues), 415 bits, see alignment E=9.4e-129 PF00005: ABC_tran" amino acids 25 to 169 (145 residues), 106.8 bits, see alignment E=1.5e-34

Best Hits

Swiss-Prot: 100% identical to DRRA_MYCTU: Doxorubicin resistance ATP-binding protein DrrA (drrA) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K09687, antibiotic transport system ATP-binding protein (inferred from 100% identity to mbo:Mb2961)

Predicted SEED Role

"ATP-dependent efflux pump essential for phthiocerol dimycocerosates translocation, ATP-binding protein DrrA-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>Rv2936 Daunorubicin-dim-transport ATP-binding protein ABC transporter DrrA (Mycobacterium tuberculosis H37Rv)
MRNDDMAVVVNGVRKTYGKGKIVALDDVSFKVRRGEVIGLLGPNGAGKTTMVDILSTLTR
PDAGSAIIAGYDVVSEPAGVRRSIMVTGQQVAVDDALSGEQNLVLFGRLWGLSKSAARKR
AAELLEQFSLVHAGKRRVGTYSGGMRRRIDIACGLVVQPQVAFLDEPTTGLDPRSRQAIW
DLVASFKKLGIATLLTTQYLEEADALSDRIILIDHGIIIAEGTANELKHRAGDTFCEIVP
RDLKDLDAIVAALGSLLPEHHRAMLTPDSDRITMPAPDGIRMLVEAARRIDEARIELADI
ALRRPSLDHVFLAMTTDPTESLTHLVSGSAR