Protein Info for Rv2896c in Mycobacterium tuberculosis H37Rv

Annotation: Conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR00732: DNA protecting protein DprA" amino acids 65 to 295 (231 residues), 272.2 bits, see alignment E=1.2e-85 PF02481: DNA_processg_A" amino acids 70 to 287 (218 residues), 217.7 bits, see alignment E=1.1e-68 PF17782: DprA_WH" amino acids 308 to 367 (60 residues), 28.3 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 100% identical to DPRA_MYCTO: Putative DNA processing protein DprA (dprA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K04096, DNA processing protein (inferred from 100% identity to mbo:Mb2920c)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>Rv2896c Conserved hypothetical protein (Mycobacterium tuberculosis H37Rv)
MIDPTARAWAYLSRVAEPPCAQLAALVRCVGPVEAADRVRRGQVGNELAQHTGARREIDR
AADDLELLMRRGGRLITPDDDEWPVLAFAAFSGAGARARPCGHSPLVLWALGPARLDEVA
PRAAAVVGTRAATAYGEHVAADLAAGLAERDVAVVSGGAYGIDGAAHRAALDSEGITVAV
LAGGFDIPYPAGHSALLHRIAQHGVLFTEYPPGVRPARHRFLTRNRLVAAVARAAVVVEA
GLRSGAANTAAWARALGRVVAAVPGPVTSSASAGCHTLLRHGAELVTRADDIVEFVGHIG
ELAGDEPRPGAALDVLSEAERQVYEALPGRGAATIDEIAVGSGLLPAQVLGPLAILEVAG
LAECRDGRWRILRAGAGQAAAKGAAARLV