Protein Info for Rv2883c in Mycobacterium tuberculosis H37Rv

Annotation: Probable uridylate kinase PyrH (UK) (uridine monophosphate kinase) (UMP kinase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02075: UMP kinase
  • amino acids 30 to 260 (231 residues), 281.3 bits, E=3e-88
• PF00696: AA_kinase
  • amino acids 32 to 239 (208 residues), 116.6 bits, E=7.6e-38

Best Hits

Swiss-Prot: 100% identical to PYRH_MYCTU: Uridylate kinase (pyrH) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K09903, uridylate kinase [EC: 2.7.4.22] (inferred from 100% identity to mbt:JTY_2899)

MetaCyc: 45% identical to UMP kinase (Escherichia coli K-12 substr. MG1655)
Cytidylate kinase. [EC: 2.7.4.14, 2.7.4.22]

Predicted SEED Role

"Uridine monophosphate kinase (EC 2.7.4.22)" (EC 2.7.4.22)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• CMP phosphorylation (2/2 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (6/9 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.14

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.22

Protein Sequence (261 amino acids)

>Rv2883c Probable uridylate kinase PyrH (UK) (uridine monophosphate kinase) (UMP kinase) (Mycobacterium tuberculosis H37Rv)
MTEPDVAGAPASKPEPASTGAASAAQLSGYSRVLLKLGGEMFGGGQVGLDPDVVAQVARQ
IADVVRGGVQIAVVIGGGNFFRGAQLQQLGMERTRSDYMGMLGTVMNSLALQDFLEKEGI
VTRVQTAITMGQVAEPYLPLRAVRHLEKGRVVIFGAGMGLPYFSTDTTAAQRALEIGADV
VLMAKAVDGVFAEDPRVNPEAELLTAVSHREVLDRGLRVADATAFSLCMDNGMPILVFNL
LTDGNIARAVRGEKIGTLVTT