Protein Info for Rv2881c in Mycobacterium tuberculosis H37Rv

Annotation: Probable integral membrane phosphatidate cytidylyltransferase CdsA (CDP-diglyceride synthetase) (CDP-diglyceride pyrophosphorylase) (CDP-diacylglycerol synthase) (CDS) (CTP:phosphatidate cytidylyltransferase) (CDP-DAG synthase) (CDP-DG synthetase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01148: CTP_transf_1
  • amino acids 37 to 304 (268 residues), 212.8 bits, E=4.1e-67

Best Hits

Swiss-Prot: 100% identical to CDSA_MYCTO: Phosphatidate cytidylyltransferase (cdsA) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 100% identity to mtu:Rv2881c)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• phosphatidylglycerol biosynthesis I (5/6 steps found)
• phosphatidylglycerol biosynthesis II (5/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (9/12 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (7/13 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (3/17 steps found)
• superpathway of phospholipid biosynthesis II (plants) (9/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism
• Phosphatidylinositol signaling system

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Protein Sequence (306 amino acids)

>Rv2881c Probable integral membrane phosphatidate cytidylyltransferase CdsA (CDP-diglyceride synthetase) (CDP-diglyceride pyrophosphorylase) (CDP-diacylglycerol synthase) (CDS) (CTP:phosphatidate cytidylyltransferase) (CDP-DAG synthase) (CDP-DG synthetase) (Mycobacterium tuberculosis H37Rv)
VTTNDAGTGNPAEQPARGAKQQPATETSRAGRDLRAAIVVGLSIGLVLIAVLVFVPRVWV
AIVAVATLVATHEVVRRLREAGYLIPVIPLLIGGQAAVWLTWPFGAVGALAGFGGMVVVC
MIWRLFMQDSVTRPTTGGAPSPGNYLSDVSATVFLAVWVPLFCSFGAMLVYPENGSGWVF
CMMIAVIASDVGGYAVGVLFGKHPMVPTISPKKSWEGFAGSLVCGITATIITATFLVGKT
PWIGALLGVLFVLTTALGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGILPSAVAAWI
VLTLLP