Protein Info for Rv2878c in Mycobacterium tuberculosis H37Rv

Annotation: Soluble secreted antigen Mpt53 precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details signal peptide" amino acids 31 to 31 (1 residues), see Phobius details PF00578: AhpC-TSA" amino acids 43 to 144 (102 residues), 55.3 bits, see alignment E=1.3e-18 PF08534: Redoxin" amino acids 44 to 137 (94 residues), 44 bits, see alignment E=4e-15 PF13098: Thioredoxin_2" amino acids 57 to 151 (95 residues), 28.6 bits, see alignment E=3.1e-10

Best Hits

Swiss-Prot: 100% identical to MPT53_MYCTO: Soluble secreted antigen MPT53 (mpt53) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_12893)

Predicted SEED Role

"Soluble secreted antigen MPT53 precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>Rv2878c Soluble secreted antigen Mpt53 precursor (Mycobacterium tuberculosis H37Rv)
MSLRLVSPIKAFADGIVAVAIAVVLMFGLANTPRAVAADERLQFTATTLSGAPFDGASLQ
GKPAVLWFWTPWCPFCNAEAPSLSQVAAANPAVTFVGIATRADVGAMQSFVSKYNLNFTN
LNDADGVIWARYNVPWQPAFVFYRADGTSTFVNNPTAAMSQDELSGRVAALTS