Protein Info for Rv2877c in Mycobacterium tuberculosis H37Rv

Annotation: Probable conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02683: DsbD
  • amino acids 9 to 220 (212 residues), 43.7 bits, E=1.6e-15

Best Hits

KEGG orthology group: None (inferred from 99% identity to mbo:Mb2902c)

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (12/12 steps found)
• taxadiene biosynthesis (engineered) (12/13 steps found)
• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• isoprene biosynthesis I (9/10 steps found)
• superpathway of ergosterol biosynthesis II (13/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.267

Use Curated BLAST to search for 1.1.1.267

Protein Sequence (287 amino acids)

>Rv2877c Probable conserved integral membrane protein (Mycobacterium tuberculosis H37Rv)
VNEALIGLAFAAGLVAALNPCGFAMLPAYLLLVVYGQDSAGRTGPLSAVGRAAAATVGMA
LGFLTVFGIFGALTISAATAVQRYLPYATVLIGLALIALGGWLLLGRGLTALTPRSLGVR
WAPTVRLGSMYGYGISYAVASLSCTIGPFLAVTGAGLRGGSVVGSVAIYLAYVAGLTLVV
GVLAVAAATASSALADRLRRILPFVNRISGALLVVVGLYVGYYGLYELRLIAGVGANPQD
AVIAAAGRLQGALAGWVNQHGAWPWAVLLVVLVVGAFAGTWFRRVRR