Protein Info for Rv2876 in Mycobacterium tuberculosis H37Rv

Annotation: Possible conserved transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 transmembrane" amino acids 52 to 71 (20 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details PF10939: DUF2631" amino acids 18 to 85 (68 residues), 102.5 bits, see alignment E=4.4e-34

Best Hits

Swiss-Prot: 100% identical to Y2876_MYCTO: Uncharacterized protein MT2944.1 (MT2944.1) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 100% identity to mtf:TBFG_12891)

Predicted SEED Role

"FIG01417063: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (104 amino acids)

>Rv2876 Possible conserved transmembrane protein (Mycobacterium tuberculosis H37Rv)
MFGQWEFDVSPTGGIAVASTEVEHFAGSQHEVDTAEVPSAAWGWSRIDHRTWHIVGLCIF
GFLLAMLRGNHVGHVEDWFLITFAAVVLFVLARDLWGRRRGWIR