Protein Info for Rv2875 in Mycobacterium tuberculosis H37Rv

Annotation: Major secreted immunogenic protein Mpt70

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF02469: Fasciclin" amino acids 70 to 191 (122 residues), 102.1 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 100% identical to MP70_MYCBO: Immunogenic protein MPB70 (mpb70) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: None (inferred from 100% identity to mtb:TBMG_01095)

Predicted SEED Role

"Cell surface lipoprotein MPT83 precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>Rv2875 Major secreted immunogenic protein Mpt70 (Mycobacterium tuberculosis H37Rv)
MKVKNTIAATSFAAAGLAALAVAVSPPAAAGDLVGPGCAEYAAANPTGPASVQGMSQDPV
AVAASNNPELTTLTAALSGQLNPQVNLVDTLNSGQYTVFAPTNAAFSKLPASTIDELKTN
SSLLTSILTYHVVAGQTSPANVVGTRQTLQGASVTVTGQGNSLKVGNADVVCGGVSTANA
TVYMIDSVLMPPA