Protein Info for Rv2860c in Mycobacterium tuberculosis H37Rv

Annotation: Probable glutamine synthetase GlnA4 (glutamine synthase) (GS-II)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 38% identical to IPUC_PSESP: Glutamate--isopropylamine ligase (ipuC) from Pseudomonas sp.

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 100% identity to mtb:TBMG_01110)

MetaCyc: 38% identical to gamma-glutamylisopropylamide synthetase (Pseudomonas sp. KIE171)
RXN-8940

Predicted SEED Role

"Glutamine synthetase family protein in hypothetical Actinobacterial gene cluster" in subsystem CBSS-262316.1.peg.2929 or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

MetaCyc Pathways

L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
ammonia assimilation cycle III (3/3 steps found)
ammonia assimilation cycle I (2/2 steps found)
L-glutamine biosynthesis I (1/1 steps found)
superpathway of ammonia assimilation (plants) (2/3 steps found)
ammonia assimilation cycle II (1/2 steps found)
L-glutamate and L-glutamine biosynthesis (4/7 steps found)
L-aspartate degradation II (aerobic) (1/3 steps found)
L-aspartate degradation III (anaerobic) (1/3 steps found)
isopropylamine degradation (2/7 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.2

Use Curated BLAST to search for 6.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>Rv2860c Probable glutamine synthetase GlnA4 (glutamine synthase) (GS-II) (Mycobacterium tuberculosis H37Rv)
VTGPGSPPLAWTELERLVAAGDVDTVIVAFTDMQGRLAGKRISGRHFVDDIATRGVECCS
YLLAVDVDLNTVPGYAMASWDTGYGDMVMTPDLSTLRLIPWLPGTALVIADLVWADGSEV
AVSPRSILRRQLDRLKARGLVADVATELEFIVFDQPYRQAWASGYRGLTPASDYNIDYAI
LASSRMEPLLRDIRLGMAGAGLRFEAVKGECNMGQQEIGFRYDEALVTCDNHAIYKNGAK
EIADQHGKSLTFMAKYDEREGNSCHIHVSLRGTDGSAVFADSNGPHGMSSMFRSFVAGQL
ATLREFTLCYAPTINSYKRFADSSFAPTALAWGLDNRTCALRVVGHGQNIRVECRVPGGD
VNQYLAVAALIAGGLYGIERGLQLPEPCVGNAYQGADVERLPVTLADAAVLFEDSALVRE
AFGEDVVAHYLNNARVELAAFNAAVTDWERIRGFERL