Protein Info for Rv2859c in Mycobacterium tuberculosis H37Rv
Annotation: Possible amidotransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y2859_MYCTU: Putative glutamine amidotransferase Rv2859c (Rv2859c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 100% identity to mbb:BCG_2881c)Predicted SEED Role
"COG2071: predicted glutamine amidotransferases in hypothetical Actinobacterial gene cluster" in subsystem CBSS-262316.1.peg.2929
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (308 amino acids)
>Rv2859c Possible amidotransferase (Mycobacterium tuberculosis H37Rv) VDLSASRSDGGDPLRPASPRLRSPVSDGGDPLRPASPRLRSPVSDGGDPLRPASPRLRSP LGASRPVVGLTAYLEQVRTGVWDIPAGYLPADYFEGITMAGGVAVLLPPQPVDPESVGCV LDSLHALVITGGYDLDPAAYGQEPHPATDHPRPGRDAWEFALLRGALQRGMPVLGICRGT QVLNVALGGTLHQHLPDILGHSGHRAGNGVFTRLPVHTASGTRLAELIGESADVPCYHHQ AIDQVGEGLVVSAVDVDGVIEALELPGDTFVLAVQWHPEKSLDDLRLFKALVDAASGYAG RQSQAEPR