Protein Info for Rv2858c in Mycobacterium tuberculosis H37Rv

Annotation: Probable aldehyde dehydrogenase AldC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 3 to 447 (445 residues), 514.5 bits, E=1.1e-158

Best Hits

KEGG orthology group: K00146, phenylacetaldehyde dehydrogenase [EC: 1.2.1.39] (inferred from 100% identity to mtc:MT2926)

Predicted SEED Role

"Aldehyde dehydrogenase in hypothetical Actinobacterial gene cluster" in subsystem CBSS-262316.1.peg.2929

MetaCyc Pathways

• L-phenylalanine degradation II (anaerobic) (3/3 steps found)
• phenylethylamine degradation I (2/2 steps found)
• phenylethanol degradation (1/2 steps found)
• phenylethylamine degradation II (1/2 steps found)
• styrene degradation (1/3 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
• superpathway of phenylethylamine degradation (4/11 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (3/27 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism
• Styrene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.39

Protein Sequence (455 amino acids)

>Rv2858c Probable aldehyde dehydrogenase AldC (Mycobacterium tuberculosis H37Rv)
MSTTQLINPATEEVLASVDHTDANAVDDAVQRARAAQRRWARLAPAQRAAGLRAFAAAVQ
AHLDELAALEVANSGHPIVSAEWEAGHVRDVLAFYAASPERLSGRQIPVAGGVDVTFNEP
MGVVGVITPWNFPMVIASWAIAPALAAGNAVLVKPAELTPLTTMRLGELAVEAGLDEDLL
QVLPGKGTVVGERFVTHPDIRKIVFTGSTEVGKRVMAGAAAQVKRVTLELGGKSANIVFH
DCDLERAATTAPAGVFDNAGQDCCARSRILVQRSVYDRFMELLEPAVHSIVVGDPGSRAT
EMGPLVSRAHRDKVAGYVPDDAPVAFRGTAPAGRGFWFPPTVLTPKRGDRTVTDEIFGPV
VVVLTFDDEADAISLANDTAYGLSGSIWTDDLSRALRVARAVESGNLSVNSHSSVRFNTP
FGGFKQSGVGRELGPDAPLQFTETKNVFIAVGEEM