Protein Info for Rv2857c in Mycobacterium tuberculosis H37Rv

Annotation: Probable short-chain type dehydrogenase/reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00106: adh_short" amino acids 11 to 201 (191 residues), 162.3 bits, see alignment E=1e-51 PF13561: adh_short_C2" amino acids 20 to 251 (232 residues), 212.4 bits, see alignment E=7.3e-67

Best Hits

Swiss-Prot: 41% identical to LVR_LEIAQ: Levodione reductase (lvr) from Leifsonia aquatica

KEGG orthology group: None (inferred from 100% identity to mbt:JTY_2874)

MetaCyc: 41% identical to levodione reductase monomer (Leifsonia aquatica)
1.1.1.M48 [EC: 1.1.1.M48]

Predicted SEED Role

"Short-chain dehydrogenase/reductase in hypothetical Actinobacterial gene cluster" in subsystem CBSS-262316.1.peg.2929

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.M48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>Rv2857c Probable short-chain type dehydrogenase/reductase (Mycobacterium tuberculosis H37Rv)
VMDLSQRLAGRVAVITGGGSGIGLAAGRRMRAEGATIVVGDVDVEAGGAAADELSGLFVP
TDVCDEDAVNGLFDGAAETYGRIDIAFNNAGISPPEDNLIENTELAAWQRVQDVNLKSVY
LCCRAALRHMVLAGKGSIVNTASFVAVMGSATSQISYTASKGGVLAMSRELGVQFARQGI
RVNALCPGPVNTPLLQELFAKNPERAARRMVHVPLGRFAEPDEIAAAVAFLASDDASFIT
ASTFLVDGGISSAYVTPL