Protein Info for Rv2855 in Mycobacterium tuberculosis H37Rv

Annotation: NADPH-dependent mycothiol reductase Mtr

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 TIGR03452: mycothione reductase" amino acids 3 to 458 (456 residues), 810.9 bits, see alignment E=1.6e-248 PF07992: Pyr_redox_2" amino acids 4 to 316 (313 residues), 162.2 bits, see alignment E=5.7e-51 PF13738: Pyr_redox_3" amino acids 119 to 304 (186 residues), 34 bits, see alignment E=5.9e-12 PF13434: Lys_Orn_oxgnase" amino acids 127 to 190 (64 residues), 23 bits, see alignment E=1.2e-08 PF00070: Pyr_redox" amino acids 174 to 249 (76 residues), 57 bits, see alignment E=7e-19 PF02852: Pyr_redox_dim" amino acids 345 to 454 (110 residues), 101.3 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 100% identical to MTR_MYCTO: Mycothione reductase (mtr) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00383, glutathione reductase (NADPH) [EC: 1.8.1.7] (inferred from 100% identity to mtu:Rv2855)

MetaCyc: 100% identical to mycothione reductase subunit (Mycobacterium tuberculosis H37Rv)
Mycothione reductase. [EC: 1.8.1.15]

Predicted SEED Role

"NADPH-dependent mycothiol reductase Mtr" in subsystem Glutathione analogs: mycothiol

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.15 or 1.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (459 amino acids)

>Rv2855 NADPH-dependent mycothiol reductase Mtr (Mycobacterium tuberculosis H37Rv)
METYDIAIIGTGSGNSILDERYASKRAAICEQGTFGGTCLNVGCIPTKMFVYAAEVAKTI
RGASRYGIDAHIDRVRWDDVVSRVFGRIDPIALSGEDYRRCAPNIDVYRTHTRFGPVQAD
GRYLLRTDAGEEFTAEQVVIAAGSRPVIPPAILASGVDYHTSDTVMRIAELPEHIVIVGS
GFIAAEFAHVFSALGVRVTLVIRGSCLLRHCDDTICERFTRIASTKWELRTHRNVVDGQQ
RGSGVALRLDDGCTINADLLLVATGRVSNADLLDAEQAGVDVEDGRVIVDEYQRTSARGV
FALGDVSSPYLLKHVANHEARVVQHNLLCDWEDTQSMIVTDHRYVPAAVFTDPQIAAVGL
TENQAVAKGLDISVKIQDYGDVAYGWAMEDTSGIVKLITERGSGRLLGAHIMGYQASSLI
QPLIQAMSFGLTAAEMARGQYWIHPALPEVVENALLGLR