Protein Info for Rv2852c in Mycobacterium tuberculosis H37Rv

Annotation: Probable malate:quinone oxidoreductase Mqo (malate dehydrogenase [acceptor])

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 PF06039: Mqo" amino acids 6 to 490 (485 residues), 696.7 bits, see alignment E=1.6e-213 TIGR01320: malate dehydrogenase (acceptor)" amino acids 7 to 488 (482 residues), 867.6 bits, see alignment E=1.2e-265 PF01266: DAO" amino acids 8 to 249 (242 residues), 47.3 bits, see alignment E=2.2e-16

Best Hits

Swiss-Prot: 100% identical to MQO_MYCBO: Probable malate:quinone oxidoreductase (mqo) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K00116, malate dehydrogenase (quinone) [EC: 1.1.5.4] (inferred from 100% identity to mra:MRA_2875)

Predicted SEED Role

"Malate:quinone oxidoreductase (EC 1.1.5.4)" in subsystem TCA Cycle (EC 1.1.5.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.5.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (493 amino acids)

>Rv2852c Probable malate:quinone oxidoreductase Mqo (malate dehydrogenase [acceptor]) (Mycobacterium tuberculosis H37Rv)
VSDLARTDVVLIGAGIMSATLGVLLRRLEPNWSITLIERLDAVAAESSGPWNNAGTGHSA
LCEMNYTPEMPDGSIDITKAVRVNEQFQVTRQFWAYAAENGILTDVRSFLNPVPHVSFVH
GSRGVEYLRRRQKALAGNPLFAGTEFIESPDEFARRLPFMAAKRAFSEPVALNWAADGTD
VDFGALAKQLIGYCVQNGTTALFGHEVRNLSRQSDGSWTVTMCNRRTGEKRKLNTKFVFV
GAGGDTLPVLQKSGIKEVKGFAGFPIGGRFLRAGNPALTASHRAKVYGFPAPGAPPLGAL
HLDLRFVNGKSWLVFGPYAGWSPKFLKHGQISDLPRSIRPDNLLSVLGVGLTERRLLNYL
ISQLRLSEPERVSALREFAPSAIDSDWELTIAGQRVQVIRRDERNGGVLEFGTTVIGDAD
GSIAGLLGGSPGASTAVAIMLDVLQKCFANRYQSWLPTLKEMVPSLGVQLSNEPALFDEV
WSWSTKALKLGAA