Protein Info for Rv2849c in Mycobacterium tuberculosis H37Rv

Annotation: Probable cob(I)alamin adenosyltransferase CobO (corrinoid adenosyltransferase) (corrinoid adotransferase activity)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00708: cob(I)yrinic acid a,c-diamide adenosyltransferase
  • amino acids 18 to 207 (190 residues), 285 bits, E=1e-89
• PF02572: CobA_CobO_BtuR
  • amino acids 24 to 207 (184 residues), 196 bits, E=3.1e-62

Best Hits

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 100% identity to mtb:TBMG_01123)

Predicted SEED Role

"Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.5.1.17)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (28/33 steps found)
• adenosylcobinamide-GDP biosynthesis from cobyrinate a,c-diamide (6/6 steps found)
• adenosylcobalamin salvage from cobalamin (5/5 steps found)
• adenosylcobinamide-GDP salvage from cobinamide I (5/5 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide I (7/8 steps found)
• adenosylcobinamide-GDP salvage from cobinamide II (5/6 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (7/9 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (25/36 steps found)
• cobalamin salvage (eukaryotic) (4/8 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Protein Sequence (207 amino acids)

>Rv2849c Probable cob(I)alamin adenosyltransferase CobO (corrinoid adenosyltransferase) (corrinoid adotransferase activity) (Mycobacterium tuberculosis H37Rv)
MPQGNPLAVPNDGLTTRARRNMPILAVHTGEGKGKSTAAFGMALRAWNAGLDIAVFQFVK
SAKWKVGEEAAFRQLGRLHDQHGIGGAVEWHKMGAGWSWTRTSRKAGTDVDRAAAAADGW
AEIALRLATQRHDFYLLDEFTYPLKWGWLDVDEVVDVLRARPGHQHVVITGRDAPQRLVA
AADLVTEMTKVKHPMDAGRKGQKGIEW