Protein Info for Rv2848c in Mycobacterium tuberculosis H37Rv

Annotation: Probable cobyrinic acid A,C-diamide synthase CobB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF01656: CbiA" amino acids 6 to 193 (188 residues), 75.5 bits, see alignment E=5.8e-25 TIGR00379: cobyrinic acid a,c-diamide synthase" amino acids 6 to 450 (445 residues), 374.1 bits, see alignment E=5.1e-116 PF13500: AAA_26" amino acids 109 to 189 (81 residues), 30.9 bits, see alignment E=3.7e-11 PF07685: GATase_3" amino acids 256 to 435 (180 residues), 88.7 bits, see alignment E=5.9e-29

Best Hits

Swiss-Prot: 100% identical to COBB_MYCTU: Hydrogenobyrinate a,c-diamide synthase (cobB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02224, cobyrinic acid a,c-diamide synthase [EC: 6.3.1.- 6.3.5.9] (inferred from 100% identity to mra:MRA_2871)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.- or 6.3.5.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>Rv2848c Probable cobyrinic acid A,C-diamide synthase CobB (Mycobacterium tuberculosis H37Rv)
MRVSAVAVAAPASGSGKTTIATGLIGALRQAGHTVAPFKVGPDFIDPGYHALAAGRPGRN
LDPVLVGERLIGPLYAHGVAGADIAVIEGVLGLFDGRIGPAGGAPAAGSTAHVAALLGAP
VILVVDARGQSHSVAALLHGFSTFDTATRIAGVILNRVGSARHEQVLRQACDQAGVAVLG
AIPRTAELELPTRYLGLVTAVEYGRRARLAVQAMTAVVARHVDLAAVIACAGSQAAHPPW
DPVIAVGNTARQPATVAIAAGRAFTFGYAEHAEMLRAAGAEVVEFDPLSETLPEGTDAVV
LPGGFPEQFTAELSANDTVRRQINELAAAGAPVHAECAGLLYLVSELDGHPMCGVVAGSA
RFTQHLKLGYRDAVAVVDSALYSVGERVVGHEFHRTAVTFADSYQPAWVYQGQDVDDVRD
GAVHSGVHASYLHTHPAATPGAVARFVAHAACNTPRA