Protein Info for Rv2839c in Mycobacterium tuberculosis H37Rv

Annotation: Probable translation initiation factor if-2 InfB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 transmembrane" amino acids 819 to 833 (15 residues), see Phobius details PF04760: IF2_N" amino acids 5 to 54 (50 residues), 48.1 bits, see alignment 2.3e-16 amino acids 316 to 362 (47 residues), 32.9 bits, see alignment 1.3e-11 TIGR00487: translation initiation factor IF-2" amino acids 308 to 899 (592 residues), 733.8 bits, see alignment E=1.7e-224 TIGR00231: small GTP-binding protein domain" amino acids 399 to 557 (159 residues), 110.1 bits, see alignment E=9.4e-36 PF01926: MMR_HSR1" amino acids 401 to 510 (110 residues), 34.3 bits, see alignment E=6.9e-12 PF00009: GTP_EFTU" amino acids 401 to 560 (160 residues), 116.3 bits, see alignment E=3.9e-37 PF00071: Ras" amino acids 402 to 555 (154 residues), 30.4 bits, see alignment E=8.4e-11 PF11987: IF-2" amino acids 679 to 791 (113 residues), 123.3 bits, see alignment E=1.5e-39

Best Hits

Swiss-Prot: 100% identical to IF2_MYCTU: Translation initiation factor IF-2 (infB) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 100% identity to mtu:Rv2839c)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (900 amino acids)

>Rv2839c Probable translation initiation factor if-2 InfB (Mycobacterium tuberculosis H37Rv)
VAAGKARVHELAKELGVTSKEVLARLSEQGEFVKSASSTVEAPVARRLRESFGGSKPAPA
KGTAKSPGKGPDKSLDKALDAAIDMAAGNGKATAAPAKAADSGGAAIVSPTTPAAPEPPT
AVPPSPQAPHPGMAPGARPGPVPKPGIRTPRVGNNPFSSAQPADRPIPRPPAPRPGTARP
GVPRPGASPGSMPPRPGGAVGGARPPRPGAPRPGGRPGAPGAGRSDAGGGNYRGGGVGAA
PGTGFRGRPGGGGGGRPGQRGGAAGAFGRPGGAPRRGRKSKRQKRQEYDSMQAPVVGGVR
LPHGNGETIRLARGASLSDFADKIDANPAALVQALFNLGEMVTATQSVGDETLELLGSEM
NYNVQVVSPEDEDRELLESFDLSYGEDEGGEEDLQVRPPVVTVMGHVDHGKTRLLDTIRK
ANVREAEAGGITQHIGAYQVAVDLDGSQRLITFIDTPGHEAFTAMRARGAKATDIAILVV
AADDGVMPQTVEAINHAQAADVPIVVAVNKIDKEGADPAKIRGQLTEYGLVPEEFGGDTM
FVDISAKQGTNIEALEEAVLLTADAALDLRANPDMEAQGVAIEAHLDRGRGPVATVLVQR
GTLRVGDSVVAGDAYGRVRRMVDEHGEDVEVALPSRPVQVIGFTSVPGAGDNFLVVDEDR
IARQIADRRSARKRNALAARSRKRISLEDLDSALKETSQLNLILKGDNAGTVEALEEALM
GIQVDDEVVLRVIDRGVGGITETNVNLASASDAVIIGFNVRAEGKATELASREGVEIRYY
SVIYQAIDEIEQALRGLLKPIYEENQLGRAEIRALFRSSKVGLIAGCLVTSGVMRRNAKA
RLLRDNIVVAENLSIASLRREKDDVTEVRDGFECGLTLGYADIKEGDVIESYELVQKERA